PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00575.1.g00260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 453aa    MW: 48661.3 Da    PI: 4.5837
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00575.1.g00260.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-16126173148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg+WT++Ed +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
  Zmw_sc00575.1.g00260.1.am.mk 126 RGSWTPQEDMRLIAYIQKHGHANWRALPKQAGLLRCGKSCRLRWINYL 173
                                   89******************************99************97 PP

2Myb_DNA-binding49.51e-15179224148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg++T +E+e +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
  Zmw_sc00575.1.g00260.1.am.mk 179 RGNFTVDEEETIIKLHGLLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 224
                                   89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-23117176IPR009057Homeodomain-like
PROSITE profilePS5129414.36121173IPR017930Myb domain
SuperFamilySSF466892.43E-29123220IPR009057Homeodomain-like
SMARTSM007171.1E-12125175IPR001005SANT/Myb domain
PfamPF002495.1E-15126173IPR001005SANT/Myb domain
CDDcd001674.10E-10128173No hitNo description
PROSITE profilePS5129424.544174228IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-25177227IPR009057Homeodomain-like
SMARTSM007176.6E-14178226IPR001005SANT/Myb domain
PfamPF002495.7E-14179224IPR001005SANT/Myb domain
CDDcd001673.03E-10181224No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MNSSAARPEL KIILSSTRVG SLGALAEQLE PRTASFPGRR VWTRKSGRGG AAILSALAYI  60
YPCSSRQLPI RAQCSASFID HPSKPQFWSL EEWQLEGDGG EIGGRVVVSD MGRGRAPCCD  120
KVGLNRGSWT PQEDMRLIAY IQKHGHANWR ALPKQAGLLR CGKSCRLRWI NYLRPDLKRG  180
NFTVDEEETI IKLHGLLGNK WSKIAACLPG RTDNEIKNVW NTHLKKKAAQ REQPKAGSTK  240
EDGAAPITSS SASSSTSTAN SSGDVGEQCG TSQEPDAIPP PLETDIDISG MLVDAFPAMA  300
APMPPQSSPC SSSTLTTSST CVGGGGVEDL IELPVIDIEP DIWDIIDGAA DVPDVWGAGH  360
GDATVPCTGA TVSTSEAGEG EASDWWLENL ERELGLCGPP EDSRAQSDLL LADTEGDPVS  420
NYFQNGPAIA ELSDRLPLCY DQRDESSAFD QEW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-2612422725127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001152187.11e-134myb-related protein Zm1
SwissprotP200241e-137MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A0A9HFK41e-136A0A0A9HFK4_ARUDO; Uncharacterized protein
TrEMBLK7U3861e-136K7U386_MAIZE; Putative MYB DNA-binding domain superfamily protein
STRINGGRMZM5G833253_P011e-136(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798